SLC8A1 Rabbit pAb (APR25931N)

In cardiac myocytes, Ca (2+) concentrations alternate between high levels during contraction and low levels during relaxation. The increase in Ca (2+) concentration during contraction is primarily due to release of Ca (2+) from intracellular stores. However, some Ca (2+) also enters the cell through the sarcolemma (plasma membrane) . During relaxation, Ca (2+) is sequestered within the intracellular stores. To prevent overloading of intracellular stores, the Ca (2+) that entered across the sarcolemma must be extruded from the cell. The Na (+) -Ca (2+) exchanger is the primary mechanism by which the Ca (2+) is extruded from the cell during relaxation. In the heart, the exchanger may play a key role in digitalis action. The exchanger is the dominant mechanism in returning the cardiac myocyte to its resting state following excitation.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC8A1 Rabbit pAb (APR25931N) .

SLC8A1; NCX1

6546

P32418

Cell membrane, Multi-pass membrane protein

WB (Homo sapiens)

WB 1:1000 - 1:2000 IHC 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 104kDa/107kDa/108kDa Observed MW: 100KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6546

https://www.uniprot.org/uniprot/P32418

WVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHVENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLAC