Sra1 Antilichaam - N-terminalgebied : HRP (ARP37345_P050-HRP)

Steroid receptor RNA activator 1

Sra, Srap, Straa1, Strra1, AA959952

24068

Q80VJ2

NP_079567

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide corresponding to a region of Mouse

Sra1 is a functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Sra1 also mediates transcriptional coactivation of steroid receptors ligand-dependently through the steroid-binding domain (AF-2) .Sra1 enhances cellular proliferation and differentiation and promotes apoptosis in vivo. Sra1 may play a role in tumorigenesis.

CFTR; Traf6; Pus1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 93%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

24kDa

Wet Ice

220

SRA1

Sra1

Rabbit

Steroid receptor RNA activator 1

NM_025291

MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLT