Sumo1 Antilichaam - N-terminal regio : HRP (ARP30639 P050-HRP)

SMT3 suppressor of mif two 3 homolog 1 (yeast)

PI, SE, Ubl, GMP1, PIC1, SMT3, Ubl1, SMTP3, Smt3C, SMT3H3, SUMO-1, SENTRIN

22218

P63166

NP_033486

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit

Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. It is involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. It may also regulate a network of genes involved in palate development.

Pten; Stat1; Pml; Casp8ap2; Traf3; Pik3c3; Npm1; Mdm2; Ube2i; Trp53; Rangap1; Ranbp2; Mthfs; Sox2; Senp2; Rbbp7; Slc1a2; Uimc1; Nfatc2ip; Irf1; Irf8; Smad4; BCL11A; AXIN1; Myb; Pax6; Sept2; Daxx; Sf1; Sp3; Pou5f1; Hif1a; Nfkb2; Junb; Jun

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

11kDa

Wet Ice

101

SUMO1

Sumo1

Rabbit

Small ubiquitin-related modifier 1

NM_009460

DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYC