SYT12 Antilichaam - N-terminalgebied: FITC (ARP59490 P050-FITC)

Synaptotagmin 12

SYT11, sytXII

91683

Q8IV01

NP_001171351

Human, Cow, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human SYT12

This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. Studies of the orthologous gene in rat have shown that the encoded protein selectively modulates spontaneous synaptic-vesicle exocytosis and may also be involved in regulating calcium independent secretion in nonneuronal cells. Alternative splicing results in multiple transcript variants. The gene has previously been referred to as synaptotagmin XI but has been renamed synaptotagmin XII to be standard with mouse and rat official nomenclature.

UBC

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

Affinity purified

0.5 mg/ml

Cow: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

46 kDa

Wet Ice

421

SYT12

SYT12

Rabbit

Synaptotagmin-12

NM_001177880.1

LLGIAAVSLWKLWTSGSFPSPSPFPNYDYRYLQQKYGESCAEAREKRVPA