TFAP2A Antilichaam - C-terminaal gebied: Biotine (ARP31160_P050-Biotine)

Transcription factor AP-2 alpha

AP-2, BOFS, AP2TF, TFAP2, AP-2alpha

7020

P05549

NP_003211

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP2A

The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS) . Three transcript variants encoding different isoforms have been found for this gene.

Biotin

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 90%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

48kDa

Wet Ice

437

TFAP2A

TFAP2A

Rabbit

Transcription factor AP-2-alpha

FGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLA