TM4SF4 Antilichaam - N-terminaal gebied : HRP (ARP46480 P050-HRP)

Transmembrane 4 L six family member 4

ILTMP, il-TMP

7104

P48230

NP_004608

Human, Cow, Guinea Pig

The immunogen is a synthetic peptide directed towards the N terminal region of human TM4SF4

TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that can regulate cell proliferation.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation. The use of alternate polyadenylation sites has been found for this gene.

FATE1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 79%; Guinea Pig: 79%; Human: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

21kDa

Strausberg, R.L., J. Cell. Sci. 114 (PT 23), 4143-4151 (2001)

Wet Ice

202

TM4SF4

TM4SF4

Rabbit

Transmembrane 4 L6 family member 4

NM_004617

CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG