TRIM41 Antilichaam - N-terminalgebied: HRP (ARP40083 P050-HRP)

Tripartite motif containing 41

RINCK

90933

Q8WV44-2

NP_963921

Human, Mouse, Rat, Dog, Horse, Pig, Rabbit, Yeast

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRI41

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM family is characterized by a signature motif composed of a RING finger, one or more B-box domains, and a coiled-coil region. This encoded protein may play a role in protein kinase C signaling. Multiple transcript variants encoding different isoforms have been found for this gene.

ZNF264; TOP3B; NCK2; ZSCAN26; ZNF138; ZSCAN21; ZNF26; MEOX2; KIFC3; EHHADH; PHC2; CSNK2A2; CHD2; AES; MORF4L1; RNPS1; ZNF266; SORBS3; ZBTB24; KRTAP10-9; ZBTB38; FAM124A; ZNF564; ZNF417; FRA10AC1; ZNF670; TRIM41; ZNF587; PUS7L; CEP44; ZFP2; ZNF329; AEN; ZN

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 91%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

56kDa

Wet Ice

518

TRIM41

TRIM41

Rabbit

E3 ubiquitin-protein ligase TRIM41

VQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELD