UGT1A7 Antilichaam - N-terminaal gebied: Biotine (ARP49438 P050-Biotine)

UDP glucuronosyltransferase 1 family, polypeptide A7

GNT1, UGT1, UDPGT, UGT1A, UGT1G, UGT-1A, UGT-1G, UGT1.1, UGT1.7, UGT1A1, UGT1-01, UGT1-07, hUG-BR1, UDPGT 1-7

54577

Q5DSZ7

NP_061950

Human

The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A7

UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Biotin

Polyclonal Antibody

IHC, WB

Affinity Purified

There is BioGPS gene expression data showing that UGT1A7 is expressed in 721_B

0.5 mg/ml

Human: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

57kDa

Lankisch, T.O., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (3), 695-701

Wet Ice

530

UGT1A7

UGT1A7

Rabbit

UDP glycosyltransferase 1 family polypeptide A7 EMBL AAR95643.1

NM_019077

VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN