Zal anti GFP-Tig mAb (AMM254N)

The green fluorescent protein (GFP) is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to light in the blue to ultraviolet range. Although many other marine organisms have similar green fluorescent proteins, GFP traditionally refers to the protein first isolated from the jellyfish Aequorea victoria. The GFP from A. victoria has a major excitation peak at a wavelength of 395 nm and a minor one at 475 nm. Its emission peak is at 509 nm, which is in the lower green portion of the visible spectrum. The GFP from the sea pansy (Renilla reniformis) has a single major excitation peak at 498 nm. GFP makes for an excellent tool in many forms of biology due to its ability to form internal chromophore without requiring any accessory cofactors, gene products, or enzymes / substrates other than molecular oxygen.In cell and molecular biology, the GFP gene is frequently used as a reporter of expression. It has been used in modified forms to make biosensors, and many animals have been created that express GFP, which demonstrates a proof of concept that a gene can be expressed throughout a given organism, in selected organs, or in cells of interest. GFP can be introduced into animals or other species through transgenic techniques, and maintained in their genome and that of their offspring. To date, GFP has been expressed in many species, including bacteria, yeasts, fungi, fish and mammals, including in human cells.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Mouse anti GFP-Tag mAb (AMM22054N) .

GFP; GFP tag; GFP-tag

IF (Homo sapiens, Mus musculus) WB (Chlorocebus sabaeus, Saccharomyces cerevisiae, Homo sapiens, Mus musculus, Other, Arabidopsis thaliana, Populus, Nicotiana tabacum L., Oryza sativa, Ctenopharyngodon idellus, Cotton bollworms, N. benthamiana, Helicoverpa armigera, Solanum tuberosum, Anatinae, Yeast, Ictalurus punctatus, Rosa rugosa Thunb, Sus scrofa, N. benthamiana plants) Co-IP (Mus musculus, Oryza sativa, Cucumis sativus , Homo sapiens) IP (Homo sapiens, Ctenopharyngodon idellus, Mus musculus)

WB 1:2000 - 1:5000 IF 1:50 - 1:100

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 27kDa Observed MW: 26KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFF