ZNF157 Antilichaam - N-terminalgebied: FITC (ARP57911_P050-FITC)

Zinc finger protein 157

HZF22

7712

P51786

Human, Rat, Horse, Pig, Rabbit

The immunogen for Anti-ZNF157 antibody is: synthetic peptide directed towards the N-terminal region of Human ZN157

This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 92%; Rat: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

55 kDa

Wet Ice

506

ZNF157

ZNF157

Rabbit

Zinc finger protein 157

TYSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNG