ZNF460 Antilichaam - N-terminalgebied: FITC (ARP50543 P050-FITC)

Zinc finger protein 460

HZF8, ZNF272

10794

Q14592

NP_006626

Human

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF460

ZNF460 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers and 1 KRAB domain. ZNF460 may be involved in transcriptional regulation.Zinc finger proteins, such as ZNF272, interact with nucleic acids and have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-322 DA991801.1 1-322 323-2011 BC118625.1 1-1689 2012-3494 AC005261.2 120007-121489 3495-3849 AK074582.1 1463-1817

CCDC67; ZNF250; FGF12; CDK11A; CBX5; UBC; SMARCAD1; Trim28

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

ZNF460 is supported by BioGPS gene expression data to be expressed in OVCAR3

0.5 mg/ml

Human: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

64kDa

Dai, J., Cytogenet. Genome Res. 103 (1-2), 74-78 (2003)

Wet Ice

562

ZNF460

ZNF460

Rabbit

Zinc finger protein 460

NM_006635

ALYVEVMLETCGLLVALGDSTKPETVEPIPSHLALPEEVSLQEQLAQGVP